PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN22225.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 447aa    MW: 50078.9 Da    PI: 6.5105
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN22225.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18.2e-103704071954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e+  LA+++gLt++qV++WF N R +
  KHN22225.1 370 FEHflHPYPNDSEKLMLASQTGLTKNQVSNWFINARVR 407
                 554459******************************88 PP

2BELL101.56e-33233303272
        BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 ++e+q+k+a+L++ll+eV+ r ++y++q++ v+ssFe++aglg+ak+Yt+lAl+a+SrhF +L+dai ++i
  KHN22225.1 233 KHEHQIKIARLITLLDEVEGRCEKYYHQMEEVVSSFEMIAGLGAAKSYTALALQAMSRHFCSLRDAILSHI 303
                 689****************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.5E-31167301IPR006563POX domain
PfamPF075262.5E-39172299IPR006563POX domain
CDDcd000861.95E-11351412No hitNo description
SMARTSM003891.1E-9351415IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-27356417IPR009057Homeodomain-like
SuperFamilySSF466891.07E-17357418IPR009057Homeodomain-like
PfamPF059205.0E-17368407IPR008422Homeobox KN domain
PROSITE profilePS5007111.888370411IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0004801Molecular Functionsedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MSNSITHLQN QFENQDLDTY GSSMRHNNAS FPEASLGAFP TSIGVVAEGS EISHTRHLMD  60
LLGAAANERN HHQTAQGLSL SLGSHMLVPS DEYRHHQRPL NPGLINPNYF MSGQEPREAC  120
NNPPVEQQHN ITSDYFFNTA GSCTFASSSS SAPLNRSPNT TTSYAAESFA AVIGNSRYLK  180
PVQSLLEDLV DVGGNVVDRI NDKYAEKLFR GSRGSARTLS SELRNNGHLL AGKHEHQIKI  240
ARLITLLDEV EGRCEKYYHQ MEEVVSSFEM IAGLGAAKSY TALALQAMSR HFCSLRDAIL  300
SHINAEKRKL FQDLPKISSG LSQLSLFDRD SRQSRMSLQQ LGVIQSQRQV WRPIRGLPET  360
SVAILRSWLF EHFLHPYPND SEKLMLASQT GLTKNQVSNW FINARVRLWK PMIEEMYKEE  420
FGESSEDSNP AGNNYLTRED TTDCVED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16357415563Homeobox protein Meis2
3k2a_B2e-16357415563Homeobox protein Meis2
4xrm_A2e-16357415563Homeobox protein Meis2
4xrm_B2e-16357415563Homeobox protein Meis2
4xrs_A1e-16357414158Homeobox protein Meis1
4xrs_B1e-16357414158Homeobox protein Meis1
5bng_A2e-16357415159Homeobox protein Meis2
5bng_B2e-16357415159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527679.10.0PREDICTED: BEL1-like homeodomain protein 11
SwissprotQ1PFD11e-102BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLA0A0B2QL780.0A0A0B2QL78_GLYSO; BEL1-like homeodomain protein 11
TrEMBLI1K7P30.0I1K7P3_SOYBN; Uncharacterized protein
STRINGGLYMA06G03210.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126452329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.11e-103BEL1-like homeodomain 11
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]